Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens guanylate cyclase activator 1A (GUCA1A), transcript variant 1 (NM_000409). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P43080 |
| Entry Name | GUC1A_HUMAN |
| Gene Names | GUCA1A C6orf131 GCAP GCAP1 GUCA1 |
| Alternative Gene Names | C6orf131 GCAP GCAP1 GUCA1 |
| Alternative Protein Names | Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 201 |
| Molecular Weight(Da) | 22920 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG |
Background
| Function | FUNCTION: Stimulates retinal guanylyl cyclase when free calcium ions concentration is low and inhibits guanylyl cyclase when free calcium ions concentration is elevated (PubMed:19459154, PubMed:30622141, PubMed:18706439, PubMed:30184081). This Ca(2+)-sensitive regulation of retinal guanylyl cyclase is a key event in recovery of the dark state of rod photoreceptors following light exposure (By similarity). May be involved in cone photoreceptor light response and recovery of response in bright light (By similarity). {ECO:0000250|UniProtKB:P43081, ECO:0000250|UniProtKB:P46065, ECO:0000269|PubMed:18706439, ECO:0000269|PubMed:30184081, ECO:0000269|PubMed:30622141}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
